LL-37 100MG — Cathelicidin Antimicrobial Peptide

LL-37 100MG — Cathelicidin Antimicrobial Peptide

€47,00
Sale price  €47,00 Regular price 
Skip to product information
LL-37 100MG — Cathelicidin Antimicrobial Peptide

LL-37 100MG — Cathelicidin Antimicrobial Peptide

€47,00
Sale price  €47,00 Regular price 

LL-37 is the 37-residue C-terminal peptide released from human cathelicidin antimicrobial protein hCAP18. It is strongly cationic and adopts an amphipathic alpha-helix in membrane-like environments, which is the structural basis of its behaviour in membrane-interaction studies.

Compound data

Compound LL-37, cathelicidin-derived peptide
Class Cationic antimicrobial peptide, 37 residues
Sequence [LL-37, 37 aa]
Parent protein hCAP18 (human cathelicidin)
Secondary structure Amphipathic alpha-helix in membrane environments
Appearance White lyophilized powder
Solubility Water soluble
Quantity 100 mg per vial
Purity 99%+, verified by HPLC and mass spectrometry
Presentation Lyophilized powder, sealed vial

Storage and handling

  • Dry powder: store at −20 °C, sealed, protected from light and moisture.
  • Bring the sealed vial to room temperature before opening — lyophilized powder is hygroscopic and draws moisture onto a cold surface.
  • After reconstitution: refrigerate at 2-8 °C, protect from light, and avoid repeated freeze-thaw cycles.
  • Highly cationic peptides adsorb to glass and plastic surfaces — low-binding tubes reduce loss when preparing dilute solutions.

What you need to reconstitute it

Material is supplied dry and has to be brought into solution before use. Bacteriostatic Water 20 mL is the standard solvent and is sold separately — step-by-step procedure in the reconstitution guide, and a comparison of solvents in bacteriostatic water vs sterile water.

Documentation

Every batch is third-party tested: HPLC for chromatographic purity, mass spectrometry for identity. New to batch documents? See how to read a COA, what 99% purity actually means and net peptide content vs gross weight.

Shipping

Ships worldwide via DHL. Free shipping on orders over $150.

Intended for laboratory and research use only. Not a medicine. Not for human or veterinary use, and not for diagnostic or therapeutic application.

You may also like