LL-37 100MG — Cathelicidin Antimicrobial Peptide
LL-37 is the 37-residue C-terminal peptide released from human cathelicidin antimicrobial protein hCAP18. It is strongly cationic and adopts an amphipathic alpha-helix in membrane-like environments, which is the structural basis of its behaviour in membrane-interaction studies.
Compound data
| Compound | LL-37, cathelicidin-derived peptide |
| Class | Cationic antimicrobial peptide, 37 residues |
| Sequence | [LL-37, 37 aa] |
| Parent protein | hCAP18 (human cathelicidin) |
| Secondary structure | Amphipathic alpha-helix in membrane environments |
| Appearance | White lyophilized powder |
| Solubility | Water soluble |
| Quantity | 100 mg per vial |
| Purity | 99%+, verified by HPLC and mass spectrometry |
| Presentation | Lyophilized powder, sealed vial |
Storage and handling
- Dry powder: store at −20 °C, sealed, protected from light and moisture.
- Bring the sealed vial to room temperature before opening — lyophilized powder is hygroscopic and draws moisture onto a cold surface.
- After reconstitution: refrigerate at 2-8 °C, protect from light, and avoid repeated freeze-thaw cycles.
- Highly cationic peptides adsorb to glass and plastic surfaces — low-binding tubes reduce loss when preparing dilute solutions.
What you need to reconstitute it
Material is supplied dry and has to be brought into solution before use. Bacteriostatic Water 20 mL is the standard solvent and is sold separately — step-by-step procedure in the reconstitution guide, and a comparison of solvents in bacteriostatic water vs sterile water.
Documentation
Every batch is third-party tested: HPLC for chromatographic purity, mass spectrometry for identity. New to batch documents? See how to read a COA, what 99% purity actually means and net peptide content vs gross weight.
Shipping
Ships worldwide via DHL. Free shipping on orders over $150.
Intended for laboratory and research use only. Not a medicine. Not for human or veterinary use, and not for diagnostic or therapeutic application.